SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257095777|ref|YP_003169418.1| from Candidatus Accumulibacter phosphatis clade IIA str. UW-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257095777|ref|YP_003169418.1|
Domain Number 1 Region: 434-576
Classification Level Classification E-value
Superfamily Ferredoxin reductase-like, C-terminal NADP-linked domain 6.55e-32
Family Flavohemoglobin, C-terminal domain 0.00063
Further Details:      
 
Domain Number 2 Region: 330-430
Classification Level Classification E-value
Superfamily Riboflavin synthase domain-like 1e-26
Family Ferredoxin reductase FAD-binding domain-like 0.00031
Further Details:      
 
Domain Number 3 Region: 565-677
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.97e-17
Family 2Fe-2S ferredoxin-related 0.04
Further Details:      
 
Domain Number 4 Region: 171-276
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.000000219
Family PNP-oxidase like 0.023
Further Details:      
 
Weak hits

Sequence:  gi|257095777|ref|YP_003169418.1|
Domain Number - Region: 35-133
Classification Level Classification E-value
Superfamily FMN-binding split barrel 0.021
Family PNP-oxidase like 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257095777|ref|YP_003169418.1|
Sequence length 689
Comment pyridoxamine 5'-phosphate oxidase-like protein [Candidatus Accumulibacter phosphatis clade IIA str. UW-1]
Sequence
MSAATASPWHRGERELQQSVGVAERMEVFGRQVIRDFMPEQHRTFYRQLPFLVIAAVDAS
GDPWATLVEARAGLAQSADARHLQINALPGQGDPAGDALMPGDGIGVLGIELQTRRRNRV
NGRVVARDDRQLTLQVEHAFGNCPQYIQAREFRFSGDPAEPFVGRTEVLVKLDAEANAMI
RAADTFFVASYVDPEGDAGRRQVDASHRGGKAGFVRIDGDVLTIPDFAGNLHFNTLGNLQ
VNPRAGLLFIDFANGDLLQLTGRTELVLAGDEVSSFQGAERLWRLHVDKAVRRRGVLKLR
WRLDEVSPNSLMTGSWEEALARQQAQALRNQWRRFRIARITNESSTIKSFHLEAADGAGL
PLFKAGQHLPIRLAIAAEAAPVIRTYTLSAAPSDGCYRISVKREGRVSQFLHDHTAVGDE
IEARAPLGNFVVDPHERRPLVLLSAGVGITPMLAMLREVVYEGVRTRRVRQTFFVHASRT
LAERAFASEMQELVERADGAVEAVRVLSQPEPTAVLGSDYDVQGRIDLRLLKAILPFDDF
DFYLCGPAAFAQDLYDGLRAMQIADERIHVEQFGPSSLRRRVTEAVTEPAPPTLPAAETS
VAVVFARTAKEARWQPGGGSLLELAEARGLTPEFSCRGGSCGTCKTRILAGQVSYTSPPA
VAMGTDEILICCSVPAAEAGGAAGLVLDL
Download sequence
Identical sequences C7RQ82
2000185590 gi|257095777|ref|YP_003169418.1| 522306.CAP2UW1_4248 WP_015768650.1.47741 2001011290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]