SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479133740|ref|YP_007762160.1| from Mycoplasma fermentans PG18

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479133740|ref|YP_007762160.1|
Domain Number 1 Region: 36-136
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000016
Family Phosphate binding protein-like 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479133740|ref|YP_007762160.1|
Sequence length 378
Comment hypothetical protein [Mycoplasma fermentans PG18]
Sequence
MYNNDMKKKKNLLRALAPIYSLPLVTFTTSCNFSVISFKGSSSMIQYLNDISKELGYEYE
MNIVGGGSGTGLSQLIHGKTDFASISKDPRFGLNSSKKKQAKKEYLENQLKTFLVAKENV
AFVLKLPKSKIQLSSGEVEAKDLNVYFNKNNWRILLESFGGQEQLTLADITLNNDSKLKE
FNITPFYKSGGANFSGTAEALSKQNPFLDIKPSEKAAKFLEDTSDKPKYDVKLENDSSNE
FWMSMKHYDKPCLGFFTLDFIKKNIEEFKRYNCLVLSYLNPDNNKYYSPLNDRELFDYVW
NRGFYLVIGLKKNYKKELKFLYTIFDPKNKAKIQKVYSKNALTFPTNDEIITNFNLRDMS
EFKWPEIMDKVKPDTKFD
Download sequence
Identical sequences C4XF44
gi|479133740|ref|YP_007762160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]