SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229580735|ref|YP_002839134.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229580735|ref|YP_002839134.1|
Domain Number 1 Region: 55-188
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 8.76e-45
Family Band 7/SPFH domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229580735|ref|YP_002839134.1|
Sequence length 267
Comment hypothetical protein YN1551_0013 [Sulfolobus islandicus Y.N.15.51]
Sequence
MAINVGDIVGIVFLIIIIIIFIAMSFRVVREWERAVVLRLGRFLRIKGPGIIFLIPFVDR
PLIVDLRVNTVEVPPQTILTRDNVTVSVDAVVYYKVVDPQKAVLSVYNYNVAVLNLAQTS
LRDIVGQMELDELLSKREEINKRIQEILDVTTEGWGIKVTAVTIRDIRLSQDLLSAMAKQ
AEAERLRRAKVILSEGERQAASILADASTYYKDNPSALQLRFLETLSDISQRGGLIIVVP
AGNEIYPTLGTSAALSTLSKKLQTETK
Download sequence
Identical sequences C3MIW0 C3MTM1 C3MZV7 C3N7T9 C3NJ45 C4KJC9 D2PDT1 F0NFF7 F0NIU5
gi|238618492|ref|YP_002913317.1| gi|229583586|ref|YP_002842087.1| gi|229577831|ref|YP_002836229.1| 419942.YN1551_0013 426118.M164_0013 427317.M1425_0013 427318.M1627_0013 429572.LS215_0013 439386.YG5714_0013 WP_012710192.1.100559 WP_012710192.1.13477 WP_012710192.1.27011 WP_012710192.1.27461 WP_012710192.1.34992 WP_012710192.1.44962 WP_012710192.1.47130 WP_012710192.1.48461 WP_012710192.1.52267 WP_012710192.1.60638 WP_012710192.1.66823 WP_012710192.1.67233 WP_012710192.1.68242 WP_012710192.1.74483 WP_012710192.1.83431 WP_012710192.1.84481 WP_012710192.1.89621 WP_012710192.1.90709 WP_012710192.1.91160 WP_012710192.1.97021 gi|227826424|ref|YP_002828203.1| gi|385772033|ref|YP_005644599.1| gi|284996420|ref|YP_003418187.1| gi|385774754|ref|YP_005647322.1| gi|227829033|ref|YP_002830812.1| gi|229580735|ref|YP_002839134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]