SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229580881|ref|YP_002839280.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229580881|ref|YP_002839280.1|
Domain Number 1 Region: 10-249
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 2.62e-68
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.000088
Further Details:      
 
Domain Number 2 Region: 237-393
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 4.83e-45
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229580881|ref|YP_002839280.1|
Sequence length 398
Comment acyl-CoA dehydrogenase [Sulfolobus islandicus Y.N.15.51]
Sequence
MVFPFKSLEDFKVEITQDHELLRSAVRDFAENILAKYVEIGEKELDIPLEVKQKAKEIGL
YGLFARQDLGGQGADYLSLLTATEEMARIWPSFSTFLLINWMFIYALSRFGNEELRKKYV
TPVANGDKVAAFAVTEPVAGSDVAGIKTTAKKLDSEYVINGRKIFITNGDIADYYLIAAR
TSPPDPKARWKGISMLVVEKDAVKPVSRIETTGLKSSHTAEILLEDVKTPAENLLGEEGN
GFKYAVSSFDFARTIVASQALGIGQAALEKMINYSLQRTAFEKKLAEFQLVQTKVSESLA
DLEVARLITYWAGTLFKNGKENEYTVAASLAKFISTESAERIILRAMSVYGGYGVTTSTG
LERMLRDLQIMKTYEGTNDIQRISAARFLYNKFIGYKV
Download sequence
Identical sequences C3NJV6
419942.YN1551_0164 WP_012716989.1.52267 gi|229580881|ref|YP_002839280.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]