SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581016|ref|YP_002839415.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581016|ref|YP_002839415.1|
Domain Number 1 Region: 60-128
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000017
Family Multidrug resistance efflux transporter EmrE 0.017
Further Details:      
 
Domain Number 2 Region: 172-267
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000262
Family Multidrug resistance efflux transporter EmrE 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229581016|ref|YP_002839415.1|
Sequence length 274
Comment hypothetical protein YN1551_0316 [Sulfolobus islandicus Y.N.15.51]
Sequence
MKILKYLLPYVTITSFNYYFSKDAITFSSPIFFNLIRYVISSIIFLSISRGKIIFNRDVI
QLAVYTTVSSLLWAYGLLYVSPAESAVLSYTMPLFSIPISFIILLERPAVLEIVGVVIGF
SGVILYGLPLVHGLTLFGSIITIVNALFWGLFTVFYRKLKGYDPITVNASQFSIGSIILA
LLLPIHHNIDPNPEFYIGIAYTSTLGGAISFFLWNMMVKAEKIPKVTVLSFSVPILTTLV
EFLLYHVLPFPIQLFGIFLMFLGILISRSRTLLS
Download sequence
Identical sequences C3NKL3
419942.YN1551_0316 WP_012717063.1.52267 gi|229581016|ref|YP_002839415.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]