SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581017|ref|YP_002839416.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581017|ref|YP_002839416.1|
Domain Number 1 Region: 162-424
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.27e-71
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0000201
Further Details:      
 
Domain Number 2 Region: 12-160
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 4.82e-53
Family Malic enzyme N-domain 0.00000633
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581017|ref|YP_002839416.1|
Sequence length 432
Comment malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+)) [Sulfolobus islandicus Y.N.15.51]
Sequence
MIYFFMVDAVELSRKYEGKIEIYPKVPITSYNDFALIYTPGVAEVSKAIYKDPDKSFELT
SRWNTIAVVTDGTRVLGLGNIGPTAAMPVMEGKSLLFKYLGGVDAIPLPINVKSADEFTN
VVKALETSFGGINLEDIESPKCFYILEKLQSMLNIPVWHDDQQGTAAAILAGLINAMILT
NKDPKESKVVFYGAGASNIAAARILAKYGFKYENIVMIDSKGPLYADREDVDHLMLHHKW
KYELAIKTNKWEAKEIKDAFSGADAVVAASTPGPNVIKKEWISLMNKEAIVFALANPVPE
IWPQDAKEAGAKIVATGRSDFPNQVNNSLIFPAIFRGVLDSRAKAITDEMTIAASEALAK
YARDRGINENYIIPRMDEWEAFYEEAAAVASKAVELGLARVKKSREEFREIAKERIIRAR
KIMNLVISTWSP
Download sequence
Identical sequences A0A157T6F0 C3NB04 C3NKL4 D0KQ76 D2PGM0 Q97UX2
WP_009989831.1.13477 WP_009989831.1.14611 WP_009989831.1.22626 WP_009989831.1.34992 WP_009989831.1.43719 WP_009989831.1.52267 WP_009989831.1.57434 WP_009989831.1.66040 gi|229580342|ref|YP_002838742.1| gi|15899581|ref|NP_344186.1| gi|384433184|ref|YP_005642542.1| 273057.SSO2869 419942.YN1551_0317 439386.YG5714_2590 gi|284998962|ref|YP_003420730.1| gi|229581017|ref|YP_002839416.1| NYSGXRC-6108b

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]