SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581089|ref|YP_002839488.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581089|ref|YP_002839488.1|
Domain Number 1 Region: 177-322
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 4.32e-46
Family Mevalonate 5-diphosphate decarboxylase 0.00048
Further Details:      
 
Domain Number 2 Region: 3-169
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 1.75e-38
Family GHMP Kinase, N-terminal domain 0.0000392
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229581089|ref|YP_002839488.1|
Sequence length 325
Comment diphosphomevalonate decarboxylase [Sulfolobus islandicus Y.N.15.51]
Sequence
MLKSVTVSAPSNIAVVKYWGKRGDERLNLPLNNSLSITLDDQLSVITKVTLSDKNIVIVN
ERILPEDEMKEYAGRVLEAFKKIVGKEFHVKVESKAKFPVNAGLASSAAGIAALTFGLNE
LLELELKPEELSKIARLGSGSACRSMFGGFVVWNKGLREDGEDSYCYQIFQHGHWSELVD
IIPILSEKEKKISSRKGMIRSAETSELMECRLKFVEKTFNEVIEAIRNRDERKFYYLVMR
HSNSMHAIILDSWPSFFYLNDTSIRIMEWIQEYGKAGYTFDAGPNPHIFTTERYVQDILE
FLKSLEIKRIIVSKVGDGPKILNRE
Download sequence
Identical sequences C3ML87 C3NAF0 C3NL52
419942.YN1551_0397 429572.LS215_2535 439386.YG5714_2509 gi|229580265|ref|YP_002838665.1| gi|229581089|ref|YP_002839488.1| WP_012714385.1.13477 WP_012714385.1.52267 WP_012714385.1.66823 gi|227831354|ref|YP_002833134.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]