SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581148|ref|YP_002839547.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581148|ref|YP_002839547.1|
Domain Number 1 Region: 2-199
Classification Level Classification E-value
Superfamily SGNH hydrolase 1.97e-38
Family TAP-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229581148|ref|YP_002839547.1|
Sequence length 201
Comment G-D-S-L family lipolytic protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MFAGDSITDREKSNNAPLGYGYVNLFYNLMLAKHPETKITVINSGISGNTVIDLIDRWDD
DVLSYKPNWISILIGINDLHKFLGGLTTFNPENYYENLRRLLKYTRKVLNNVNFILMTPF
YISRNKLEGGFRAKVLELLPQYIEKVRLLSNEFSATYIDLHDTFKKLVNIREPNVYAPEP
VHPNFTGHMVIALKLLEALEI
Download sequence
Identical sequences C3NA92 C3NLB1 D2PFV0
419942.YN1551_0467 439386.YG5714_2443 WP_009988429.1.13477 WP_009988429.1.34992 WP_009988429.1.43719 WP_009988429.1.52267 WP_009988429.1.57434 WP_009988429.1.8449 gi|229581148|ref|YP_002839547.1| gi|284998818|ref|YP_003420586.1| gi|229580207|ref|YP_002838607.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]