SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581162|ref|YP_002839561.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581162|ref|YP_002839561.1|
Domain Number 1 Region: 186-283
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.00000000127
Family Multidrug resistance efflux transporter EmrE 0.02
Further Details:      
 
Weak hits

Sequence:  gi|229581162|ref|YP_002839561.1|
Domain Number - Region: 59-141
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.000288
Family Multidrug resistance efflux transporter EmrE 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229581162|ref|YP_002839561.1|
Sequence length 284
Comment hypothetical protein YN1551_0488 [Sulfolobus islandicus Y.N.15.51]
Sequence
MFSKNSLPIISRYSILKYLTDYFHNMRDKIILFLGGVAFGTAAIFVKFCTITPPFITFLR
FLIAGILLLPFVSKRRRKIILKRFILPSLFLSLHMLFFVSSVFLTTIASSTILVSTSPIF
AMLFKKKIDPFIIMAILGIFIMNFNTSFGYIFGNVLAILSAISFAIYTYFLSRLDYDSLS
IIPIIYLISSIFMIPVLPFYGLGDINPISILAVLGLVLVPTLIGHGSVIYTANKLPISLV
TSAELIEPVMATILAIPIFHQIPDTQELIGGTITLISIYFAFRR
Download sequence
Identical sequences C3MKQ3 C3NA75 C3NLC5 D2PFT7 Q97UE8
WP_009990865.1.13477 WP_009990865.1.14611 WP_009990865.1.22626 WP_009990865.1.34992 WP_009990865.1.52267 WP_009990865.1.57434 WP_009990865.1.66040 WP_009990865.1.66823 WP_009990865.1.67233 gi|229581162|ref|YP_002839561.1| gi|284998805|ref|YP_003420573.1| GO.4289 gi|229580190|ref|YP_002838590.1| gi|15899778|ref|NP_344383.1| gi|227831289|ref|YP_002833069.1| 273057.SSO3074 419942.YN1551_0488 429572.LS215_2458 439386.YG5714_2424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]