SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581251|ref|YP_002839650.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581251|ref|YP_002839650.1|
Domain Number 1 Region: 8-119
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000161
Family Cgl2762-like 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581251|ref|YP_002839650.1|
Sequence length 154
Comment hypothetical protein YN1551_0592 [Sulfolobus islandicus Y.N.15.51]
Sequence
MVQAYEEEKDARIKERILAVKLHLVDGKSEKEVSKMLNKGYSTIKLWVGEYKKEGLNGLR
DKPRSGRPRKAEKEKQILEDQPQKYGMQQEYWTMRTLKIKQQGIEYKKSRLYELVHELGY
NLVKPRPTNVQAEKNMREDFKIGRRGAVLSRVGQ
Download sequence
Identical sequences C3NLY0
gi|229581251|ref|YP_002839650.1| 419942.YN1551_0592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]