SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581296|ref|YP_002839695.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581296|ref|YP_002839695.1|
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily all-alpha NTP pyrophosphatases 4.84e-20
Family MazG-like 0.0000383
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229581296|ref|YP_002839695.1|
Sequence length 81
Comment MazG nucleotide pyrophosphohydrolase [Sulfolobus islandicus Y.N.15.51]
Sequence
MELKELQSKMKEMYFEKDSQRGIYATFTWLVEEVGELAEALLSNDSDSIQEELADVIAWT
VSIANLKGIDIEEALKKKYKL
Download sequence
Identical sequences C3MJZ0 C3MRU1 C3N0T0 C3N916 C3NM25 C4KJV7 D2PF05 F0NC25 F0NQG0
gi|385774082|ref|YP_005646649.1| gi|229581296|ref|YP_002839695.1| gi|227831158|ref|YP_002832938.1| gi|238620594|ref|YP_002915420.1| gi|284998656|ref|YP_003420424.1| gi|229580043|ref|YP_002838443.1| gi|229585631|ref|YP_002844133.1| WP_012712109.1.100559 WP_012712109.1.13477 WP_012712109.1.27011 WP_012712109.1.27461 WP_012712109.1.34992 WP_012712109.1.44962 WP_012712109.1.47130 WP_012712109.1.48461 WP_012712109.1.52267 WP_012712109.1.60638 WP_012712109.1.66823 WP_012712109.1.67233 WP_012712109.1.68242 WP_012712109.1.74483 WP_012712109.1.83431 WP_012712109.1.84481 WP_012712109.1.89621 WP_012712109.1.90709 WP_012712109.1.91160 WP_012712109.1.97021 gi|385776727|ref|YP_005649295.1| 419942.YN1551_0644 426118.M164_2149 427317.M1425_2145 427318.M1627_2225 429572.LS215_2308 439386.YG5714_2272 gi|227828402|ref|YP_002830182.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]