SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581400|ref|YP_002839799.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581400|ref|YP_002839799.1|
Domain Number 1 Region: 161-269
Classification Level Classification E-value
Superfamily DNA primase core 0.000000000915
Family DNA primase DnaG catalytic core 0.0067
Further Details:      
 
Weak hits

Sequence:  gi|229581400|ref|YP_002839799.1|
Domain Number - Region: 92-120
Classification Level Classification E-value
Superfamily Rad51 N-terminal domain-like 0.0424
Family NusA extra C-terminal domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229581400|ref|YP_002839799.1|
Sequence length 402
Comment DNA primase [Sulfolobus islandicus Y.N.15.51]
Sequence
MKYDIKLRFEVEGIVEKTDVIGAIFGQTENLFGDEFDLRELQDKGRLGRIIVEIRTKGGK
SEGEIIIPSNLDRIETALIAAMVESVDKVGPYNSKFELIEIEDIRAEKLKKIIERAKGIL
SSWSKEKSLDIKEVINEISSAVKVGEITEYGPERLPAGPDVDKDPNLIIVEGRADVINLL
RYGYKNVIAVEGATSRIPETVVSLSKMKKTVIAFLDGDHGGDLILKELLSNNVKIDFVAR
APVGREVEELTGKEIAKALSNMMPLTQYLKKIQEAEQAIAKNVIAKEEKPIQLEATQQLV
QITLPQNVLEEIKKLPGTLEGVLYDNNWNLIEKVQVRDIIPKLEAYEDNKVAYIVFDGVI
TQRLLDLASQKNIKMIIGARIGGINKRPQNVDILTFTDIISS
Download sequence
Identical sequences C3MJP0 C3MYZ8 C3N047 C3N8R1 C3NMQ7 C4KJ86 D2PEB8
gi|284998553|ref|YP_003420321.1| gi|229579939|ref|YP_002838338.1| gi|229585530|ref|YP_002844032.1| gi|238620492|ref|YP_002915318.1| gi|229581400|ref|YP_002839799.1| WP_012712008.1.13477 WP_012712008.1.27461 WP_012712008.1.34992 WP_012712008.1.44962 WP_012712008.1.47130 WP_012712008.1.48461 WP_012712008.1.52267 WP_012712008.1.60638 WP_012712008.1.66823 WP_012712008.1.68242 WP_012712008.1.74483 WP_012712008.1.83431 WP_012712008.1.84481 WP_012712008.1.90709 WP_012712008.1.97021 gi|227828300|ref|YP_002830080.1| 419942.YN1551_0752 426118.M164_2048 427317.M1425_2041 427318.M1627_2121 429572.LS215_2206 439386.YG5714_2167 gi|227831058|ref|YP_002832838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]