SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581456|ref|YP_002839855.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581456|ref|YP_002839855.1|
Domain Number 1 Region: 12-207
Classification Level Classification E-value
Superfamily SIS domain 2.07e-38
Family mono-SIS domain 0.0000391
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581456|ref|YP_002839855.1|
Sequence length 209
Comment 6-phospho 3-hexuloisomerase [Sulfolobus islandicus Y.N.15.51]
Sequence
MSSSLDDYPLSLKTMYDIAEFILRAAKAIKPEQTSKMISELENFYKNNRNGKVLVMGAGR
SGLVGRAFAMRLLHLGFNSYVLGETIVPAIGKNDIVVAISGSGRTKLILTAAEAAKEAGA
KLISITSYFDSPLAKISDVVIEIPGRTKYSKNEDYFARQILGITEPLAPLGTLFEDTTQI
FLDGIVAELMIRLKKTEEDLRLVHANIEL
Download sequence
Identical sequences C3MJ53 C3MYU5 C3MZZ2 C3N875 C3NF37 C4KJ33 F0NI36 F0NQ75
419942.YN1551_0808 426118.M164_1993 427317.M1425_1987 427318.M1627_2065 429572.LS215_2152 439386.YG5714_2110 gi|385773925|ref|YP_005646492.1| gi|385776566|ref|YP_005649134.1| gi|229579885|ref|YP_002838284.1| gi|238620439|ref|YP_002915265.1| gi|229585475|ref|YP_002843977.1| gi|227828247|ref|YP_002830027.1| gi|229581456|ref|YP_002839855.1| gi|227831005|ref|YP_002832785.1| WP_012711955.1.100559 WP_012711955.1.13477 WP_012711955.1.27011 WP_012711955.1.27461 WP_012711955.1.44962 WP_012711955.1.47130 WP_012711955.1.48461 WP_012711955.1.52267 WP_012711955.1.60638 WP_012711955.1.66823 WP_012711955.1.67233 WP_012711955.1.68242 WP_012711955.1.74483 WP_012711955.1.83431 WP_012711955.1.84481 WP_012711955.1.89621 WP_012711955.1.90709 WP_012711955.1.91160 WP_012711955.1.97021

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]