SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581548|ref|YP_002839947.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581548|ref|YP_002839947.1|
Domain Number 1 Region: 49-121
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000108
Family Cgl2762-like 0.044
Further Details:      
 
Weak hits

Sequence:  gi|229581548|ref|YP_002839947.1|
Domain Number - Region: 7-54
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0179
Family Transcriptional factor domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581548|ref|YP_002839947.1|
Sequence length 244
Comment Insertion element protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MGRKPVFRQDVSCPSCGSHHVVKCGRPLGRQKFLCRDCGKYFLGDASYHHHSRKLREEAL
RMYANGMSMRAISRVLNVPLGTVFTWIKRYGRKKHEKLVELWGRAKELVKGKVVAKVVDE
MWTYLYKNARAFYKWVFTCYVYTKLGVYLIYSVGDRDESTFLEVKKYLPDEGRWVSDDYN
LYFWLKDHTVVSPVNPNESFHSSLRDRLIRFKRTTKAVNRSIRTMMYSIALVLWERRLIP
EFVA
Download sequence
Identical sequences C3NFC9
WP_012717276.1.52267 419942.YN1551_0914 gi|229581548|ref|YP_002839947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]