SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581642|ref|YP_002840041.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581642|ref|YP_002840041.1|
Domain Number 1 Region: 104-263
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 3.94e-29
Family Aminoacid dehydrogenase-like, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 4-101
Classification Level Classification E-value
Superfamily Aminoacid dehydrogenase-like, N-terminal domain 2.01e-24
Family Shikimate dehydrogenase-like 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581642|ref|YP_002840041.1|
Sequence length 269
Comment shikimate dehydrogenase [Sulfolobus islandicus Y.N.15.51]
Sequence
MLEEINYDTKLFGLIGKNIKYTLSPYIHNFSFTTLGINAVYLVFDLDEMKFNRIINGLLE
IAEGLNVTIPYKEEVMKYLDNTDTYSTRIQAVNTIYKKGGYNTDYLAIKNLVRKKIGNMS
GYECYVYGAGGAAKAAAFALSELGCSSISIVNRTNLRANELVELLNKNGYNASIKENCNS
TSNIVVVNSTPNPSVVPENCIQKSELVIEFVYKPVETELIKNAKKYSIKYIDGLEILVNQ
AVEAEKIWFNKSVSDEKIIEYLYARKLVW
Download sequence
Identical sequences C3NG01
WP_012717305.1.52267 gi|229581642|ref|YP_002840041.1| 419942.YN1551_1012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]