SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581643|ref|YP_002840042.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581643|ref|YP_002840042.1|
Domain Number 1 Region: 4-357
Classification Level Classification E-value
Superfamily Chorismate synthase, AroC 1.7e-125
Family Chorismate synthase, AroC 0.000000275
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229581643|ref|YP_002840042.1|
Sequence length 391
Comment chorismate synthase [Sulfolobus islandicus Y.N.15.51]
Sequence
MPGNSFGKLFRVTTFGESHGPAVGVVIDGVPAGLPLTVEDIKFELEFRKPGRLYVSGRRE
KDEPEILSGIFNNRTTGSPIAVIVRNTDVISSFYEEIRYKPRPGHADLPFIMKYGYENWD
YRGGGRASARETVGRVIAGAVAKKLLMLADTWIAGHLRSLGPEELNEEVTFEEVLCSKYS
PVRASKKVLEEKYEALIKKATQEGDSYGGIAEVITKNPPIGLGEPVFDKMKAELAKAIMS
IPAVTGFEYGLGFMVSKMKGSEANDEIIRKDNKIGWKYNYAGGILGGLTNGEDLIVRCAF
KPTSSIRKPQKTIDLRNLEETYISVIGRHDPAVAIRGVTVVESMVALTLVDHAMRAGVIP
LVKLTEEQGNIVQQRWERYVRSCKPMEESQL
Download sequence
Identical sequences C3NG02
gi|229581643|ref|YP_002840042.1| 419942.YN1551_1013 WP_012717306.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]