SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581650|ref|YP_002840049.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581650|ref|YP_002840049.1|
Domain Number 1 Region: 3-74
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000011
Family Thioltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229581650|ref|YP_002840049.1|
Sequence length 264
Comment hypothetical protein YN1551_1020 [Sulfolobus islandicus Y.N.15.51]
Sequence
MEVQIFTHKNCVECNMLLEYLENKGLLGKVKIIDTELYPFLAFERGVISTPSIFIDGKLV
YAGIVDFEEFERILSGEKVTRQIDKDKLVEKLMLGIVDSFAATAWLYINRDFDSFLAQKD
FVMAVTGLSLLDEKEREEYYNYLRNIMIKEGEKYLEEWKPRMLRNISSNFIREIFWLYET
KISKEVVMQKYSVEVFAHWLMVRGGAVGRVGLRIYPLSDSTLMRRVLEAYNFMLGNYDDI
FNKVQKEQTELKAKNREQVRYLQI
Download sequence
Identical sequences C3MRB0 C3N7G7 C3NG09 D2PDD0
gi|229581650|ref|YP_002840049.1| gi|227830788|ref|YP_002832568.1| gi|284998302|ref|YP_003420070.1| 419942.YN1551_1020 429572.LS215_1928 439386.YG5714_1905 gi|229579684|ref|YP_002838083.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]