SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581686|ref|YP_002840085.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581686|ref|YP_002840085.1|
Domain Number 1 Region: 4-51
Classification Level Classification E-value
Superfamily Ribosomal protein L39e 3.01e-18
Family Ribosomal protein L39e 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581686|ref|YP_002840085.1|
Sequence length 51
Comment 50S ribosomal protein L39e [Sulfolobus islandicus Y.N.15.51]
Sequence
MSRNKPVAKKFRLAKALKANSPIPIWIVLKTRGRVRYNPFRRNWRRNDLKV
Download sequence
Identical sequences C3NGA3
gi|229581686|ref|YP_002840085.1| WP_012717318.1.52267 419942.YN1551_1056

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]