SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581716|ref|YP_002840115.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581716|ref|YP_002840115.1|
Domain Number 1 Region: 256-590
Classification Level Classification E-value
Superfamily SIS domain 1.58e-88
Family double-SIS domain 0.00000522
Further Details:      
 
Domain Number 2 Region: 2-234
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 9.44e-65
Family Class II glutamine amidotransferases 0.00000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581716|ref|YP_002840115.1|
Sequence length 591
Comment glucosamine--fructose-6-phosphate aminotransferase [Sulfolobus islandicus Y.N.15.51]
Sequence
MCGIIGVVSNKESKRLAELVVSCLNRLEYRGYDSVGVAALSSANLEVRKAKGTVEEVVRK
KNIKELSGYAFLGHTRWATHGAPTDYNAHPHTDCSNNIAVIHNGTIRNFKELRDELQSLG
HKFKSETDTEVIPHMMEEYMKRGMDTFQAFRSAVKSIQGSFAILAVVKGERRIFFAKRDN
PLVIGLGDDKTFIASDIPSFLPYTRKVIVISDGELGYVTPNTVYIEDENDNPIDVTSRIK
IIDWDASSASKEGYPHFMLKEIHESPIAVKDTISGLLSEIDKVSEIAEEIRKSSRIIVTA
AGTSYHAGFYFSLLLARKGYMSIPLIASEYHNFRVKKGDIVIAISQSGETLDVKMGIRKF
KEEGAKIIALTNVIESDIARESDYKLYMRAGPEIGVAATKTFTSEIASLLFLYSLIEKES
ISYLENAHETVRNIITETEGFAKKIGEELANKNNAYYLGRGLGVPLAMEGALKIKEIAYI
HAEAYPAGESKHGPIALVENGFPIVFINDGELVDELEKNLQEMKARGGKTYSISVNKRLN
FADTEILVNTDEKLSSLAIAPIIQLIAYYASVKRGYDPDKPRNLAKTVTVE
Download sequence
Identical sequences C3NGD3
WP_012717333.1.52267 gi|229581716|ref|YP_002840115.1| 419942.YN1551_1086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]