SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581717|ref|YP_002840116.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581717|ref|YP_002840116.1|
Domain Number 1 Region: 3-189
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 2.81e-39
Family GHMP Kinase, N-terminal domain 0.0003
Further Details:      
 
Domain Number 2 Region: 179-284
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.15e-21
Family Mevalonate kinase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581717|ref|YP_002840116.1|
Sequence length 314
Comment mevalonate kinase [Sulfolobus islandicus Y.N.15.51]
Sequence
MRVEAKVPLKLTLFGEHAVVYDRPAIAMTISESLKVRVSESDRFLIISPSLNIRGVKLDL
NEMKIESDEAKKVLRYVFEVLNYFEMKKPVKIEIDSTVEPSVGLGTSAAVIVGTVAAYSK
YLGIDLNRDEIAKISHDIELKVQGIASRMDTYTETYGGLIYFLPGGEGFERIDTNFELTA
GYIRRSMSTADVLWRVRKLKELNKEVFDNILDVIGEITNRAKSLIIEQNYEELGLLMYVN
HGLLFSLGITSPEADEIVSRAKQLRIKGCKISGGGAGGSIICIKSVEAEVLLKSYNARIV
NSTLIKDGVDISII
Download sequence
Identical sequences C3MR45 C3MXD4 C3MZ80 C3N7A0 C3NGD4 C4KIF8 D2PD64 F0NHU3 F0NPY8 M9UAB5
gi|238620214|ref|YP_002915040.1| gi|385776328|ref|YP_005648896.1| gi|229581717|ref|YP_002840116.1| gi|229579617|ref|YP_002838016.1| WP_012711699.1.100559 WP_012711699.1.13477 WP_012711699.1.27011 WP_012711699.1.27461 WP_012711699.1.34992 WP_012711699.1.44962 WP_012711699.1.47130 WP_012711699.1.48461 WP_012711699.1.52267 WP_012711699.1.60638 WP_012711699.1.66823 WP_012711699.1.67233 WP_012711699.1.68242 WP_012711699.1.74483 WP_012711699.1.83431 WP_012711699.1.84481 WP_012711699.1.89621 WP_012711699.1.90709 WP_012711699.1.91160 WP_012711699.1.97021 gi|479326007|ref|YP_007866062.1| gi|227830723|ref|YP_002832503.1| gi|284998236|ref|YP_003420004.1| gi|227827986|ref|YP_002829766.1| gi|229585255|ref|YP_002843757.1| 419942.YN1551_1087 426118.M164_1769 427317.M1425_1722 427318.M1627_1840 429572.LS215_1862 439386.YG5714_1838 gi|385773693|ref|YP_005646260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]