SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581789|ref|YP_002840188.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581789|ref|YP_002840188.1|
Domain Number 1 Region: 49-108
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000272
Family Recombinase DNA-binding domain 0.068
Further Details:      
 
Domain Number 2 Region: 13-52
Classification Level Classification E-value
Superfamily Sigma3 and sigma4 domains of RNA polymerase sigma factors 0.0000327
Family Sigma4 domain 0.025
Further Details:      
 
Weak hits

Sequence:  gi|229581789|ref|YP_002840188.1|
Domain Number - Region: 100-136
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000119
Family Tetracyclin repressor-like, N-terminal domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229581789|ref|YP_002840188.1|
Sequence length 150
Comment hypothetical protein YN1551_1160 [Sulfolobus islandicus Y.N.15.51]
Sequence
MSEEEIIEKVKKMYEEGLSIRQIANQLELSYSRVRRMLIKAKVNFRGKVPNDKIQKIIEM
GKQGYSANRISKELNINFNTVLRIFKKYNLGKKRRKLDRKEIEKIREEYNKGNSIYKIAK
ELNISTNLVVYHLKKMGLYRPIRESSPTSA
Download sequence
Identical sequences C3MQW2 C3MWV0 C3N6L7 C3N705 C3NGK6 C4KI88 D2PCZ4
WP_012711633.1.100559 WP_012711633.1.13477 WP_012711633.1.27461 WP_012711633.1.34992 WP_012711633.1.44962 WP_012711633.1.47130 WP_012711633.1.48461 WP_012711633.1.52267 WP_012711633.1.60638 WP_012711633.1.66823 WP_012711633.1.68242 WP_012711633.1.83431 WP_012711633.1.84481 WP_012711633.1.89621 WP_012711633.1.90709 WP_012711633.1.97021 gi|284998167|ref|YP_003419934.1| 419942.YN1551_1160 426118.M164_1698 427317.M1425_1651 427318.M1627_1767 429572.LS215_1779 439386.YG5714_1743 gi|229581789|ref|YP_002840188.1| gi|227830640|ref|YP_002832420.1| gi|227827918|ref|YP_002829698.1| gi|238620144|ref|YP_002914970.1| gi|229579523|ref|YP_002837921.1| gi|229585185|ref|YP_002843687.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]