SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581803|ref|YP_002840202.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581803|ref|YP_002840202.1|
Domain Number 1 Region: 137-304
Classification Level Classification E-value
Superfamily AraD/HMP-PK domain-like 1.02e-47
Family Phosphomethylpyrimidine kinase C-terminal domain-like 0.00026
Further Details:      
 
Weak hits

Sequence:  gi|229581803|ref|YP_002840202.1|
Domain Number - Region: 33-72
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 0.000206
Family NE1354 0.059
Further Details:      
 
Domain Number - Region: 80-156
Classification Level Classification E-value
Superfamily ARM repeat 0.0337
Family Clathrin adaptor core protein 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229581803|ref|YP_002840202.1|
Sequence length 314
Comment hypothetical protein YN1551_1174 [Sulfolobus islandicus Y.N.15.51]
Sequence
MFDLNLTIVLKSPLSIFDDIFITSIRVLEAKRLRELHMSQTRIANLLGVSQPAVKQYLDE
DENSYIKRLQNLGLTREEIDDFLDKLTQLLINGDPKQVMQYISVFFLSNLSRLKFCKYHK
MIDSEIPVDCDICKSLYKENEEEMMELALSMLQNESVAELIPEVLSNLAFAKANAKREED
VLAIPGRITKIRNLPTPASKPMWGGSKHLAKVLLSVMKNHPAVRSVMNIKYDEKVEMILK
EIGYKFKKVGPQNDLGNERIAETIAAVFDEGTDVVIHLGGTGIEANTYVFGRDPLDVVKK
IINISVKYKEIFSP
Download sequence
Identical sequences A0A157SY07 C3MQU8 C3MWT6 C3N6K3 C3N6Z1 C3NGM0 C4KI74 D2PCY0 Q97ZV8
gi|227830626|ref|YP_002832406.1| gi|238620130|ref|YP_002914956.1| 273057.SSO0468 419942.YN1551_1174 426118.M164_1685 427317.M1425_1638 427318.M1627_1753 429572.LS215_1765 439386.YG5714_1729 gi|229579509|ref|YP_002837907.1| gi|229581803|ref|YP_002840202.1| gi|15897395|ref|NP_342000.1| WP_010922984.1.100559 WP_010922984.1.13477 WP_010922984.1.27011 WP_010922984.1.27461 WP_010922984.1.34992 WP_010922984.1.43719 WP_010922984.1.44962 WP_010922984.1.47130 WP_010922984.1.48461 WP_010922984.1.52267 WP_010922984.1.60638 WP_010922984.1.66823 WP_010922984.1.67233 WP_010922984.1.68242 WP_010922984.1.74483 WP_010922984.1.83431 WP_010922984.1.84481 WP_010922984.1.8449 WP_010922984.1.89621 WP_010922984.1.90709 WP_010922984.1.91160 WP_010922984.1.97021 gi|227827904|ref|YP_002829684.1| gi|284998153|ref|YP_003419920.1| gi|229585171|ref|YP_002843673.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]