SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229581829|ref|YP_002840228.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581829|ref|YP_002840228.1|
Domain Number 1 Region: 155-265
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 3.57e-27
Family ProC C-terminal domain-like 0.0038
Further Details:      
 
Domain Number 2 Region: 5-154
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5e-25
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229581829|ref|YP_002840228.1|
Sequence length 274
Comment pyrroline-5-carboxylate reductase [Sulfolobus islandicus Y.N.15.51]
Sequence
MQDLTIGILGAGKIGSAIVRAIRLKYPSIHVIATARKDETLRNVKDLEVETTKDNNYAVN
KSDVIILSVKPQHFPTVLRQVGIESWRDKVVISIMAGVKLSTLSTLLNNAEVYRAMPNIN
AIVYKSTTTIAENNGKSRELVENIFKTLGNVYWLPEEYLDIWTALVGSGPAFISEIIDAL
SLGAVACGMQREIAYNAVLDMISGTIIMLKEGKIDHPMLLRDQVTTPVGTTIRGLMVMEA
KSVKSALIETIEASYKRAVEIGNEIDKSIRNNSK
Download sequence
Identical sequences C3NGP6
419942.YN1551_1200 gi|229581829|ref|YP_002840228.1| WP_012717378.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]