SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229581954|ref|YP_002840353.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229581954|ref|YP_002840353.1|
Domain Number 1 Region: 21-431
Classification Level Classification E-value
Superfamily L-aspartase-like 3.77e-89
Family L-aspartase/fumarase 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229581954|ref|YP_002840353.1|
Sequence length 459
Comment argininosuccinate lyase [Sulfolobus islandicus Y.N.15.51]
Sequence
MGNALTNSEKSKGTVMLYRKWGSEKDEVVNYTSSIDSDKEIMEEVKLTMKAHIISLYLSG
YIKKETTKKILAALNEFKEISQGYEDVHEALEDFLLKNVGEEAGWIGLGRSRNDHVATAL
RLKLRNKLIELLTEINSLRKTLLDKAKEHITTIFPSYTHLQLAQPTTFAHYLTYIEEELA
SRWEIIFFTLKLVNRSPLGSGAIVGTNVKIDREKEAELLGFDDIVYNTLSATSSRADIIT
TISELTVLMVVLSRIAEDLIFFSSNKLLKLPDSHVSTSSLMPQKRNPVTMEILRAKVSES
IGILTSLLSIYKGLPTGYNLDLQEMNKYYWLAVNYTISSIRVLESLFSQIQINKVNIDES
SLATDDAELLSINKKVPYRSAYFEIAKKVREGSYKSTLKIEDSINMKAVIGSPNFDLITN
LIKSRKTKLEEDEKEIEVYKLKIISKVGELQVIENGIEE
Download sequence
Identical sequences C3NH21
WP_012717411.1.52267 419942.YN1551_1337 gi|229581954|ref|YP_002840353.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]