SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582026|ref|YP_002840425.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582026|ref|YP_002840425.1|
Domain Number 1 Region: 86-177
Classification Level Classification E-value
Superfamily Ribosomal protein L6 6.48e-24
Family Ribosomal protein L6 0.00017
Further Details:      
 
Domain Number 2 Region: 2-85
Classification Level Classification E-value
Superfamily Ribosomal protein L6 2.13e-19
Family Ribosomal protein L6 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229582026|ref|YP_002840425.1|
Sequence length 181
Comment 50S ribosomal protein L6 [Sulfolobus islandicus Y.N.15.51]
Sequence
MQIVILREEIEIPSNVNVDLKDSVIKMKGPKGEVVKDFSFARGIQISLDGNKIVLETTFA
NRRKKAAFYSIVSHIKNMITGVTKGYRYYLKIIYTHFPTSVKVVGNEVQITNLIGEKNIR
RAPILQGVKVTVKGEDIVVEGPNLDAVAQTAANIEAASKITGFDRRIFSDGIFIYKKEVV
E
Download sequence
Identical sequences C3MQ75 C3MVJ4 C3N5U3 C3NEF9 C3NH93 C4KHH2 D2PC87 F0NHK7 F0NM48 M9U9G3
gi|229582026|ref|YP_002840425.1| gi|227830403|ref|YP_002832183.1| gi|385776017|ref|YP_005648585.1| gi|227827707|ref|YP_002829487.1| gi|229584911|ref|YP_002843413.1| 419942.YN1551_1412 426118.M164_1430 427317.M1425_1436 427318.M1627_1486 429572.LS215_1531 439386.YG5714_1431 gi|385773379|ref|YP_005645945.1| gi|284997910|ref|YP_003419677.1| WP_012711434.1.100559 WP_012711434.1.13477 WP_012711434.1.27011 WP_012711434.1.27461 WP_012711434.1.34992 WP_012711434.1.44962 WP_012711434.1.47130 WP_012711434.1.48461 WP_012711434.1.52267 WP_012711434.1.60638 WP_012711434.1.66823 WP_012711434.1.67233 WP_012711434.1.68242 WP_012711434.1.74483 WP_012711434.1.83431 WP_012711434.1.84481 WP_012711434.1.89621 WP_012711434.1.90709 WP_012711434.1.91160 WP_012711434.1.97021 gi|479325693|ref|YP_007865748.1| gi|238619878|ref|YP_002914704.1| gi|229579222|ref|YP_002837620.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]