SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582036|ref|YP_002840435.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582036|ref|YP_002840435.1|
Domain Number 1 Region: 74-173
Classification Level Classification E-value
Superfamily Ribosomal protein S3 C-terminal domain 1.06e-25
Family Ribosomal protein S3 C-terminal domain 0.00075
Further Details:      
 
Domain Number 2 Region: 2-83
Classification Level Classification E-value
Superfamily Prokaryotic type KH domain (KH-domain type II) 4.97e-24
Family Prokaryotic type KH domain (KH-domain type II) 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229582036|ref|YP_002840435.1|
Sequence length 216
Comment 30S ribosomal protein S3 [Sulfolobus islandicus Y.N.15.51]
Sequence
MKVKIDEYLAKQYYNAEYAGVEVLKTPIGTRVIIYAGRPSMIIGRGGRNIKQLAQIFEKV
FGLENPQITITNVENPELNARVMAFRLAIALEKGYHFRRAAFISMRRIMNAGALGAEIII
SGKLTTERARYEKLKEGIVYKSGQQLEKMIDRAIAIAMLKPGIFGVEVVITKPLKIEDKI
SLKESPSVPQEVSVTNVTFIEESSQKSEEKGEGEKE
Download sequence
Identical sequences C3MQ65 C3MVI4 C3N5T3 C3NEE9 C3NHA3 C4KHG2 D2PC77 F0NHJ7 F0NM38 M9U9F3
gi|227830393|ref|YP_002832173.1| gi|229579212|ref|YP_002837610.1| gi|229582036|ref|YP_002840435.1| gi|227827697|ref|YP_002829477.1| gi|479325683|ref|YP_007865738.1| gi|229584901|ref|YP_002843403.1| gi|385776007|ref|YP_005648575.1| gi|284997900|ref|YP_003419667.1| gi|385773369|ref|YP_005645935.1| 419942.YN1551_1422 426118.M164_1420 427317.M1425_1426 427318.M1627_1476 429572.LS215_1521 439386.YG5714_1421 gi|238619868|ref|YP_002914694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]