SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582106|ref|YP_002840505.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|229582106|ref|YP_002840505.1|
Domain Number - Region: 94-137
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00457
Family Iron-dependent repressor protein 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229582106|ref|YP_002840505.1|
Sequence length 156
Comment hypothetical protein YN1551_1494 [Sulfolobus islandicus Y.N.15.51]
Sequence
MERDEEELIRIIRMWYPLFELDKEAVIMIPDELVFDVKDLARKYGVKIQILKMRRRTKYT
FVAWVPPKKEEEEEDDEETEVEVIEKQDRDTIKEMIYDFIKQKKECRVNDIKNFFSTKGI
EVSEDKIREMLRELHSEKKILYRDTIKLIETRRDET
Download sequence
Identical sequences C3NHH3
gi|229582106|ref|YP_002840505.1| WP_012717464.1.52267 419942.YN1551_1494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]