SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582110|ref|YP_002840509.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582110|ref|YP_002840509.1|
Domain Number 1 Region: 8-59
Classification Level Classification E-value
Superfamily YebC-like 0.0000876
Family YebC-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229582110|ref|YP_002840509.1|
Sequence length 70
Comment hypothetical protein YN1551_1498 [Sulfolobus islandicus Y.N.15.51]
Sequence
MSLLKADWDTIERAIEKMLNDHMRTWGSYDYFVIDDVTILVKVYAEGNNRLMFTIKAKLA
GEKLEVVEVS
Download sequence
Identical sequences C3NHH7
419942.YN1551_1498 WP_012717468.1.52267 gi|229582110|ref|YP_002840509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]