SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582113|ref|YP_002840512.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|229582113|ref|YP_002840512.1|
Domain Number - Region: 8-44
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.000222
Family CopG-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229582113|ref|YP_002840512.1|
Sequence length 57
Comment hypothetical protein YN1551_1501 [Sulfolobus islandicus Y.N.15.51]
Sequence
MVNRVYTAVKLSEEERKILEIIAKSYDITMSDVIRIAITEYTQKHRNDLEKIKEGTT
Download sequence
Identical sequences C3NHI0
gi|229582113|ref|YP_002840512.1| 419942.YN1551_1501 WP_012717471.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]