SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582146|ref|YP_002840545.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582146|ref|YP_002840545.1|
Domain Number 1 Region: 9-419
Classification Level Classification E-value
Superfamily ADC synthase 3.53e-142
Family ADC synthase 0.000000000000233
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582146|ref|YP_002840545.1|
Sequence length 421
Comment anthranilate synthase component I [Sulfolobus islandicus Y.N.15.51]
Sequence
MEVHPINEFASPFEVFKCIERDFKVAGLLESIGGPQYKARYSVIAWSTNGYLKIHDDPVN
ILNSYLKDLKLVDIPGLFKGGMIGYISYDAVRFWEKIRDLKPAAEDWPYAEFFIPDNIII
YDHNEGKVYVNADLSSVGGCGDMGEFRISFYDESLNKNNYEKIVSESLEYIRSGYIFQVV
LSRFYRYLFSGDPLRIYYNLRRINPSPYMFYLKFDEKYLIGSSPELLFRVQDNIVETYPI
AGTRPRGSDQEEDLKLELELMNSEKDKAEHLMLVDLARNDLGKVCVPGTVRVPELMYVEK
YSHVQHIVSKVIGTLKKKYNALNVLSATFPAGTVSGAPKPMAMNIIETLEEYKRGPYAGA
VGFISADGNAEFAIAIRTAFLNKELLRIHAGAGIVYDSNPESEYFETEHKLKALKTAIGV
S
Download sequence
Identical sequences C3MPW0 C3MV87 C3NHL3 C4KH52 D2PK05 F0NEX8 F0NR39 M9UDL2
WP_012711333.1.100559 WP_012711333.1.27011 WP_012711333.1.34992 WP_012711333.1.52267 WP_012711333.1.66823 WP_012711333.1.67233 WP_012711333.1.68242 WP_012711333.1.91160 WP_012711333.1.97021 gi|284997711|ref|YP_003419478.1| gi|227827600|ref|YP_002829380.1| gi|227830288|ref|YP_002832068.1| gi|385775904|ref|YP_005648472.1| gi|229582146|ref|YP_002840545.1| gi|238619758|ref|YP_002914584.1| gi|479325586|ref|YP_007865641.1| gi|385773270|ref|YP_005645836.1| 419942.YN1551_1535 426118.M164_1311 427317.M1425_1328 429572.LS215_1415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]