SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582202|ref|YP_002840601.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582202|ref|YP_002840601.1|
Domain Number 1 Region: 5-75
Classification Level Classification E-value
Superfamily AF1782-like 4.32e-20
Family AF1782-like 0.00082
Further Details:      
 
Domain Number 2 Region: 82-214
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 8.16e-17
Family Cytidylyltransferase 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582202|ref|YP_002840601.1|
Sequence length 226
Comment cytidyltransferase [Sulfolobus islandicus Y.N.15.51]
Sequence
MDVDELRKRIEKYIKGMDERLKNIDSANNKVVELARLYTEDSKYYLEKGDYVTALVDIVY
AEGLLDAKEIYENNDPKSNVSKKVFVAGTFDILHPGHIEFLKEASKYGRVYVTVARDSNS
ERIKGRKPINDEQTRLEIIKSVRYVFDAILGDQEDFLKSVERINPDIIFLGPDQRVDETK
FLEELKKRGLSPQIIRLNERIRKWPHSSTTDIINEIKKRYCKLEQR
Download sequence
Identical sequences C3MPQ4 C3NDY4 C3NHR9 D2PJU9
gi|229582202|ref|YP_002840601.1| gi|229579047|ref|YP_002837445.1| gi|284997655|ref|YP_003419422.1| 419942.YN1551_1591 429572.LS215_1359 439386.YG5714_1257 WP_012713660.1.13477 WP_012713660.1.34992 WP_012713660.1.52267 WP_012713660.1.66823 gi|227830232|ref|YP_002832012.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]