SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582203|ref|YP_002840602.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582203|ref|YP_002840602.1|
Domain Number 1 Region: 59-189
Classification Level Classification E-value
Superfamily Riboflavin kinase-like 3.6e-40
Family CTP-dependent riboflavin kinase-like 0.00023
Further Details:      
 
Domain Number 2 Region: 2-47
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000803
Family MarR-like transcriptional regulators 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582203|ref|YP_002840602.1|
Sequence length 190
Comment hypothetical protein YN1551_1592 [Sulfolobus islandicus Y.N.15.51]
Sequence
MLNFSQQSISRKLKELEDDKLIVRIISKEGEIIRLTEEGERFLSSCLSSLKDAILSLHSL
EIKGNIVSGLGEGKIFLSMDYYKNHINKVMGFDPYPGTLNIIIYDKLSLENRLLLDSSPS
LIVPEYKQKDRVLGAVRLYPASINKLTPAAVVIPLRTIHPKSVIEVISPFHLREKLNLKD
GNEVTIEVYV
Download sequence
Identical sequences C3NHS0
419942.YN1551_1592 WP_012717506.1.52267 gi|229582203|ref|YP_002840602.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]