SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582214|ref|YP_002840613.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582214|ref|YP_002840613.1|
Domain Number 1 Region: 4-87
Classification Level Classification E-value
Superfamily AlbA-like 4.32e-24
Family DNA-binding protein AlbA 0.000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229582214|ref|YP_002840613.1|
Sequence length 89
Comment DNA/RNA-binding protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MTEKLNEIVVRKTKNVEDHVLDVIVLFNQGIDEVILKGIGREISKAVDVYNSLKDRLGDG
IQLVNVQTGSEVRDRRRISYILLRLKRVY
Download sequence
Identical sequences C3MPP2 C3MYN6 C3N5B8 C3NDX2 C3NHT1 C4KGY4 D2PJT7 F0NHG9 F0NPL3 M9U6G3 P74762
gi|227830220|ref|YP_002832000.1| gi|229582214|ref|YP_002840613.1| gi|229579035|ref|YP_002837433.1| 419942.YN1551_1603 426118.M164_1244 427317.M1425_1260 427318.M1627_1310 429572.LS215_1347 439386.YG5714_1245 WP_012711268.1.100559 WP_012711268.1.13477 WP_012711268.1.27011 WP_012711268.1.27461 WP_012711268.1.34992 WP_012711268.1.44962 WP_012711268.1.47130 WP_012711268.1.48461 WP_012711268.1.52267 WP_012711268.1.60638 WP_012711268.1.66823 WP_012711268.1.67233 WP_012711268.1.68242 WP_012711268.1.74483 WP_012711268.1.83431 WP_012711268.1.84481 WP_012711268.1.89621 WP_012711268.1.90709 WP_012711268.1.91160 WP_012711268.1.97021 gi|229584736|ref|YP_002843238.1| gi|479325519|ref|YP_007865574.1| gi|284997643|ref|YP_003419410.1| gi|227827533|ref|YP_002829313.1| gi|238619690|ref|YP_002914516.1| gi|385773202|ref|YP_005645768.1| gi|385775836|ref|YP_005648404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]