SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582243|ref|YP_002840642.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582243|ref|YP_002840642.1|
Domain Number 1 Region: 104-272
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 4.71e-57
Family NadC C-terminal domain-like 0.0000149
Further Details:      
 
Domain Number 2 Region: 2-103
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 2.77e-18
Family NadC N-terminal domain-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229582243|ref|YP_002840642.1|
Sequence length 275
Comment nicotinate-nucleotide pyrophosphorylase [Sulfolobus islandicus Y.N.15.51]
Sequence
MIEWIYVKRLWDYLEEDVMPEDITTKFLEGIKARGVVKCKDSGILAGNRFVIPFLNYLGF
SNINGEKDGSEVNKGDVVLLFEGNADVLTVERLILNFLGKLSGIATITNLMVKRAREVNP
NVRISGTRKTTPGFRLFEKYAIEVGGGDPHRYNLSDAVLIKDNHIALYGNIEELIKRVKS
SVSFTKIIEVEVSSYEDAIRAYKAGADAILLDNMKPYEILPIVNELKGKVILEASGGITP
DNVVDYARTGVDIISSGYTTHSSRSLDFSLDVEKI
Download sequence
Identical sequences C3MPL1 C3MYK3 C3NDU2 C3NHW0 C4KGV0 F0NHD7 F0NPI3
gi|229579005|ref|YP_002837403.1| gi|227830189|ref|YP_002831969.1| gi|227827500|ref|YP_002829280.1| gi|238619656|ref|YP_002914482.1| gi|385775804|ref|YP_005648372.1| gi|229582243|ref|YP_002840642.1| 419942.YN1551_1634 426118.M164_1208 427317.M1425_1224 429572.LS215_1316 439386.YG5714_1213 WP_012711235.1.100559 WP_012711235.1.13477 WP_012711235.1.27011 WP_012711235.1.47130 WP_012711235.1.52267 WP_012711235.1.60638 WP_012711235.1.66823 WP_012711235.1.67233 WP_012711235.1.68242 WP_012711235.1.83431 WP_012711235.1.89621 WP_012711235.1.91160 WP_012711235.1.97021 gi|385773172|ref|YP_005645738.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]