SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582310|ref|YP_002840709.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582310|ref|YP_002840709.1|
Domain Number 1 Region: 3-209
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.11e-36
Family DsbA-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582310|ref|YP_002840709.1|
Sequence length 225
Comment DSBA oxidoreductase [Sulfolobus islandicus Y.N.15.51]
Sequence
MVVKITFFHDVLCPFCFVTSRRLRSVARKFNDEIVVKHKAFMIISSLDDLKAAAPTEEEA
RELFKQEFSIIKRYFPDYDPEKVIGKGKITWVWSLPPLMACKAAEYQRGDNGYWDYFDKA
QERFFLEGENVNDDNVLIQIAEELGLDIEKFKEDFKSKKARMSVYEDEAEAHAMGIRGVP
ALLVNDYWLIRGVQDETYLESVIEDLLSNGGEPKKVKLKAYWEAT
Download sequence
Identical sequences C3MPE4 C3NDM3 C3NI27 D2PJI4 F0NGS4 M9U8Q5
WP_012713593.1.13477 WP_012713593.1.34992 WP_012713593.1.52267 WP_012713593.1.66823 WP_012713593.1.67233 WP_012713593.1.91160 gi|479325432|ref|YP_007865487.1| gi|385775736|ref|YP_005648304.1| gi|284997540|ref|YP_003419307.1| gi|227830123|ref|YP_002831902.1| gi|229578936|ref|YP_002837334.1| 419942.YN1551_1706 429572.LS215_1246 439386.YG5714_1145 gi|229582310|ref|YP_002840709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]