SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582313|ref|YP_002840712.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582313|ref|YP_002840712.1|
Domain Number 1 Region: 17-434
Classification Level Classification E-value
Superfamily L-aspartase-like 8.64e-112
Family L-aspartase/fumarase 0.0000000197
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582313|ref|YP_002840712.1|
Sequence length 445
Comment fumarate hydratase [Sulfolobus islandicus Y.N.15.51]
Sequence
MDYVLLLMKYTDTAPKLFMNTGTRFPRRIIWAMGVLKKSCAKVNADLGLLDKKIANSIIK
ASEDLIDGKLDDKIVLDVFQTGSGTGLNMNVNEVIAEVASSYSNLKVHPNDHVNFGQSSN
DTVPTAIRIAAVAEVTNRLLPALQQIISSLNKKAEEYKDVVKAGRTHLRDALPVTLGQEL
SAYADAFQHEREQVMNILEYVKELPIGGTATGTGLNTHPEFQERVINEINRITGLGFKPA
NRFRAMRLLTDLLLLSGALRNIAVNLYRLGQDIRLMFSGPLTGLNEIDLPTQEEIAGSSI
MPGKTNPVTVEATLLISAQVVGLDHANQFASMLGEFELSMGIPLVGYNIVTQVNFVSEAL
EKMSKLVIDGMVANVEKMKRYAESSPSLITIVSPVIGYDKASEIGKKLNKGMSIREALRE
LGYSDNEINKILDLSKLVKPGFTAK
Download sequence
Identical sequences C3MPE1 C3NI30 D2PJI1
419942.YN1551_1709 429572.LS215_1243 WP_012713591.1.34992 WP_012713591.1.52267 WP_012713591.1.66823 WP_012713591.1.89621 gi|229582313|ref|YP_002840712.1| gi|284997537|ref|YP_003419304.1| gi|227830120|ref|YP_002831899.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]