SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582327|ref|YP_002840726.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582327|ref|YP_002840726.1|
Domain Number 1 Region: 39-197
Classification Level Classification E-value
Superfamily vWA-like 1.06e-28
Family Integrin A (or I) domain 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582327|ref|YP_002840726.1|
Sequence length 380
Comment von Willebrand factor type A [Sulfolobus islandicus Y.N.15.51]
Sequence
MTLSLRVDTSHKYSFSGDVRYIFKVLLVPEKLGSATGFHYIVALDTSGSMTGYKIELAKQ
GAIELFKRIPKGNKVSFITFSSNVNVIKEFVDPLDLTNEILQIAAGGQTALYTAILTANS
LAKKYQMPTYLLLLTDGNPTDETNVGNYLKLPYFEKMQVYSFGIGDDYNEQLLQNISDKT
SGVMYHISDANEIPQKLPQKAVTQIAAKNVTVDIAAEGNVKLLNYATTPVKVNGIENVIK
IFGETILPANYEGSFLTVKVNYEDPVTNKLESLLQVVQVKRAQDQNTFVSGINNDVINEY
RYYELLDKYAKQVQAEQLIEATKTLNQLNEIAQQTRRIDFMETTRRLSEGLETTKRIGTV
EQTKRLSKEVTSEVTRKLRE
Download sequence
Identical sequences C3MPC9 C3NDK8 C3NI44
gi|229578921|ref|YP_002837319.1| gi|229582327|ref|YP_002840726.1| 419942.YN1551_1728 429572.LS215_1231 439386.YG5714_1130 gi|227830108|ref|YP_002831887.1| WP_012713579.1.13477 WP_012713579.1.52267 WP_012713579.1.66823

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]