SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582420|ref|YP_002840819.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|229582420|ref|YP_002840819.1|
Domain Number - Region: 29-59
Classification Level Classification E-value
Superfamily AF1782-like 0.00314
Family AF1782-like 0.01
Further Details:      
 
Domain Number - Region: 59-131
Classification Level Classification E-value
Superfamily SPOC domain-like 0.0589
Family Ku70 subunit middle domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229582420|ref|YP_002840819.1|
Sequence length 157
Comment PaREP1 family protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MMEELIKKAEEMGIDVEDLIITAMSRKDPQEGIKLRLTLARKYMAEAEEYLKKGDSVQAS
EKVYKVAEEVVKALAEKFNLPEYQQAVKEGRWYAYTLGSASASLSKMLGEWVVNGWSSAY
FLHVWGFHESKLSVTDIIPYLEGVKKLLENAEKVFGS
Download sequence
Identical sequences C3NID7
WP_012717593.1.52267 gi|229582420|ref|YP_002840819.1| 419942.YN1551_1831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]