SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229582439|ref|YP_002840838.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582439|ref|YP_002840838.1|
Domain Number 1 Region: 11-136
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8.91e-27
Family SSO2064-like 0.000000406
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582439|ref|YP_002840838.1|
Sequence length 144
Comment hypothetical protein YN1551_1854 [Sulfolobus islandicus Y.N.15.51]
Sequence
MSWEKSGKEGRLLRWYDVMEAEKYEYTVGPAGEQFFNGLKQGKIVGSKCRKCGRVFVPAR
SYCEHCFVKIENYVEVNKDEAYVDSYTIIYNDDEGNKLAQPVFIALIRFPNVEGGLLCYA
EGNVKVEAKAKITSFEWPLRVKVD
Download sequence
Identical sequences C3MNN0 C3NDA2 C3NIF6 D2PHH8
2014024767 WP_012713363.1.13477 WP_012713363.1.34992 WP_012713363.1.52267 WP_012713363.1.66823 gi|227829859|ref|YP_002831638.1| gi|284997059|ref|YP_003418826.1| 419942.YN1551_1854 429572.LS215_0946 439386.YG5714_1019 gi|229578815|ref|YP_002837213.1| gi|229582439|ref|YP_002840838.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]