SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582443|ref|YP_002840842.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582443|ref|YP_002840842.1|
Domain Number 1 Region: 3-224
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 5.5e-55
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000826
Further Details:      
 
Domain Number 2 Region: 212-366
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 3.06e-43
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582443|ref|YP_002840842.1|
Sequence length 371
Comment acyl-CoA dehydrogenase [Sulfolobus islandicus Y.N.15.51]
Sequence
MSEKELFIESLREFLKRDVEKIATKIDKEDYYPRDLVRKLGELGFLIPLTNGLSHYDMMI
ILEEIAKVSGSLALIADAQGELAGEMIRLYADERQRKEFLEPMSKGEMIGSFALTEPSGG
SDIGSMKTFAEKRNGLWRIKGHKMWITQGLYADIFVTVTRTGSSRHDLSVFIVPRGNCVE
TRKIEVMGNRGTGTAEVIFHDCEVSKDYVVGEVNNGWNMVNSVLEIGRLAISGIAIGLAE
AALEEALKWARSRTAFGNSIYDFQGIRWYFADSVAKLNAVKSMAKDVSNKFDENSKDKGV
YVAMLKLLSAIIANEIVDISLQVFGGMGYAKGTTIERIYRDARLLRIGEGTDEVQRHIIA
KYIERYGIPYI
Download sequence
Identical sequences C3ND98 C3NIG0 C4KFA8
gi|229578811|ref|YP_002837209.1| WP_012716020.1.100559 WP_012716020.1.13477 WP_012716020.1.52267 WP_012716020.1.89621 WP_012716020.1.97021 419942.YN1551_1858 426118.M164_0707 439386.YG5714_1015 gi|238619167|ref|YP_002913992.1| gi|229582443|ref|YP_002840842.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]