SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582493|ref|YP_002840892.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|229582493|ref|YP_002840892.1|
Domain Number - Region: 31-63
Classification Level Classification E-value
Superfamily AF1782-like 0.00105
Family AF1782-like 0.007
Further Details:      
 
Domain Number - Region: 37-153
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0126
Family HBL-like 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582493|ref|YP_002840892.1|
Sequence length 160
Comment PaREP1 family protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MKKFPELRKYTNPVRVRLVILCQKKLKVCFIMFIVMSISTSAEIYYEEAEEFLSKGDLVQ
ACEKYYKAAEEAIKLLVIENNLKEIINEAEEHGWDSKTLNDAVTELSYKLGDNIIDMWAS
AVTLFTARKFMDKDLIENYKKDIKTLIEEAKQRFSIKVLK
Download sequence
Identical sequences C3ND03 C3NIL0
gi|229582493|ref|YP_002840892.1| WP_012715993.1.13477 WP_012715993.1.52267 419942.YN1551_1915 439386.YG5714_0959 gi|229578755|ref|YP_002837153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]