SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582557|ref|YP_002840956.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582557|ref|YP_002840956.1|
Domain Number 1 Region: 4-177
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 6.54e-55
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0000152
Further Details:      
 
Domain Number 2 Region: 185-290
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 2.62e-21
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229582557|ref|YP_002840956.1|
Sequence length 295
Comment molybdopterin dehydrogenase FAD-binding [Sulfolobus islandicus Y.N.15.51]
Sequence
MSLVYPAPFEYFAPTSLKEALELLSKYGDEAKILAGGQSLIISMKLRIISPKYIIDINNI
PNLSYINESEGYLRLGALTRYSDLEYSDLIKSKYPLLYESVKHLADPIVRNWGTVGGNVC
YNHPGNNLPAVMLAYNAEFVATSLSGSRVIKATDFFLGPFQTALRQDEILTEIRIPIPKP
RNGGHYIKLERRVGDFAIISTAVNLSLDYDGTVREAGIGIGGASNNPVKVTKAEESLVGN
KINDNLIKEVGKIVTDVIKPVEEPFGPPADYKKAMAGVVTIRAIKQAIKRALGGV
Download sequence
Identical sequences C3NIS4
419942.YN1551_1997 gi|229582557|ref|YP_002840956.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]