SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229582611|ref|YP_002841010.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229582611|ref|YP_002841010.1|
Domain Number 1 Region: 169-388
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 7.63e-78
Family CAT-like 0.0000119
Further Details:      
 
Domain Number 2 Region: 3-86
Classification Level Classification E-value
Superfamily Single hybrid motif 6.54e-25
Family Biotinyl/lipoyl-carrier proteins and domains 0.00066
Further Details:      
 
Domain Number 3 Region: 112-152
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0000000000876
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229582611|ref|YP_002841010.1|
Sequence length 394
Comment hypothetical protein YN1551_2054 [Sulfolobus islandicus Y.N.15.51]
Sequence
MGKEVLMPKLGLTMTKGKIVQWKKKEGDRVQEGEDLVIIETEKITTAVKAVASGILLKIY
AKEGEEVPVGQIIAYIGEIGEKPPSLSTKPTLVSEQQQGQSTRIEEAKAISEVRASPRAR
RLAKEKGIDLVKIKGTGPGGMITEDDVIRELENIEKGVKFTATGLRVKEVIPMTAIRQEI
SRRMVQSLQTMAQVTLNIEINANSLVKIKNEVESKYSMKITYTDVLVKVVAKLIRSHPFL
NATLEGDQIKIIEDVNIGIAVALDQGLIVPVIRNADIKPITEIVKESHELADKARENKLN
PDEVTGGTFTISNLGMYDIDSFTPIINPPQTAILGVGRIRKAPVVIGDNISIGYVMWLSL
TFDHRVLDGHTAAKFLKELTEILEDENRLRAFLS
Download sequence
Identical sequences C3NIX8
WP_012717700.1.52267 419942.YN1551_2054 gi|229582611|ref|YP_002841010.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]