SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|229583026|ref|YP_002841425.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583026|ref|YP_002841425.1|
Domain Number 1 Region: 3-146
Classification Level Classification E-value
Superfamily ThrRS/AlaRS common domain 1.06e-31
Family AlaX-like 0.0000216
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229583026|ref|YP_002841425.1|
Sequence length 150
Comment alanyl-tRNA synthetase-like protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MDQVEIRTHTALHVVKGAVRKVLGAKWTASTYVNSNHGRLTVKFERKPSDQEMDKVFELA
NEKVRKNLPIIIEVLPREEAERKYGDEIYDLFLISAEVRELSIVVIPDWSINACNKQHTK
FTSEIGEIIKDYWRYRNSKQLLEISFDIKC
Download sequence
Identical sequences A0A0E3MK30 C3NA59 C3NLF0 D0KUL8 D2PG74 Q97YQ3
gi|384434658|ref|YP_005644016.1| 273057.SSO1271 419942.YN1551_2563 439386.YG5714_0453 gi|229583026|ref|YP_002841425.1| gi|15898113|ref|NP_342718.1| WP_009990028.1.13477 WP_009990028.1.14611 WP_009990028.1.22626 WP_009990028.1.34992 WP_009990028.1.52267 WP_009990028.1.57434 WP_009990028.1.66040 WP_009990028.1.8449 WP_009990028.1.93834 IGBMC-0060-000 gi|284996871|ref|YP_003418638.1| gi|229578267|ref|YP_002836665.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]