SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583066|ref|YP_002841465.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583066|ref|YP_002841465.1|
Domain Number 1 Region: 101-489
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.88e-103
Family Amylase, catalytic domain 0.00000000000226
Further Details:      
 
Domain Number 2 Region: 494-560
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 2.73e-24
Family alpha-Amylases, C-terminal beta-sheet domain 0.00011
Further Details:      
 
Domain Number 3 Region: 3-89
Classification Level Classification E-value
Superfamily E set domains 2.62e-18
Family E-set domains of sugar-utilizing enzymes 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229583066|ref|YP_002841465.1|
Sequence length 561
Comment malto-oligosyltrehalose trehalohydrolase [Sulfolobus islandicus Y.N.15.51]
Sequence
MAFGYRLDRNAATFNLWAPYQRNVKLKILNKGIYEMERDEKGYFTITLNNVKVGDRYKYI
LDDGSEVPDPASRYQPEGVHGHSEIISLDFKGDDENGVKVKREDLIIYELHTSTFTSEGT
FEGVIKKLDYLKELGVTAIEIMPIAQFPGKKDWGYDGVYLYAVQNSYGGPIGFRNLVNEA
HKLGLAIILDVVYNHVGPEGNYMAKLGPYFSEKYKTPWGLAFNFDDAGSDEVRKFILENV
EYWINESHVDGFRLDAVHAIIDNSPKHILEDIADVVHKYGKIVITESDLNDPRVVNPKEK
CGYNTDAQWVDDFHHAIHAFLTGERQGYYSDFGSLDDIVKSYKEVFVYDGKYSNFRRKTH
GKPIGDLDGCKFVVYIQNHDQVGNRGGGERLIKLVDKESYKIAAALYMLSPYIPMIFMGE
EYGEENPFYYFSDFSDPKLIQGVREGRKRDNGQETDPQSDSTFNASKLSWKVNDDIFSFY
KTLIKIRKEYGLACNRKLTVENGNHWLTVKGNGYLVVYVFSQSIIEMKYRGTLVLSSNNS
FPSQIAENKYKLEKGFALYKL
Download sequence
Identical sequences C3NLJ0
gi|229583066|ref|YP_002841465.1| WP_012718006.1.52267 419942.YN1551_2616

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]