SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583067|ref|YP_002841466.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583067|ref|YP_002841466.1|
Domain Number 1 Region: 150-491,520-596
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.74e-129
Family Amylase, catalytic domain 0.00000017
Further Details:      
 
Domain Number 2 Region: 14-160
Classification Level Classification E-value
Superfamily E set domains 5.6e-45
Family E-set domains of sugar-utilizing enzymes 0.0025
Further Details:      
 
Domain Number 3 Region: 610-714
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00000000216
Family alpha-Amylases, C-terminal beta-sheet domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|229583067|ref|YP_002841466.1|
Sequence length 718
Comment glycogen debranching protein GlgX [Sulfolobus islandicus Y.N.15.51]
Sequence
MSVFFRTRDRPLRPGDPYPLGSNWIEDEDGVNFSLFSENAEKVELLLYSQTNQKYPKEII
EVKNRTGDLWHILVPGLRPGQLYAYKVYGPYKPALGLRFNPNKVLIDPYAKAINGNVIWN
DAVFGYKIGDQNQDLSYDERDSSEYVPKSVVINPYFEWDDEDFIKRNKVPLKDTVIYEVH
VKGFTKLRLDLPENIRGSYEGLASEQMISYLKDLGITTVELMPVFHFIDQRFLIDKGLTN
YWGYDPINFFSPECRYSSSGCLGEQVFSFKKMVNELHNAGIEVIIDVVYNHTAEGNHLGP
TLSFRGIDNIAYYMLQPDNKRYYLDFTGTGNTLNLSHPRVIQMVLDSLRYWVTDMHVDGF
RFDLAAALARELYSVNMLNTFFIALQQDPILSRVKLIAEPWDVGQGGYQVGNFPHQWAEW
NGKYRDSIRRFWRGEALPYSEIANRLLGSPDIYLGNNKTPFASINYVTSHDGFTLEDLVS
YNQKHNEANGFNNQDGMNENYSWNCGAEGTINDQNVIMCREKQKRNFMITLLISQGTPMI
LGGDELSRTQRGNNNAFCQDNEITWFDWNLDERKSKFLGFVKKMIQFYKAHPVFRRERYF
QGKKLFGMPLKDVTFYTPDGKEVDEKTWNSPTQTVIFVLEGSVMDEINIYGERIADDSFL
IILNANPNNVKVKFQKGKWELVVCSYLREIKPEERIVEGEKELEIEGRTALVYRRIEL
Download sequence
Identical sequences C3NA11 C3NLJ1 D2PG21
gi|284996818|ref|YP_003418585.1| gi|229583067|ref|YP_002841466.1| WP_012715572.1.13477 WP_012715572.1.34992 WP_012715572.1.52267 gi|229578219|ref|YP_002836617.1| 419942.YN1551_2617 439386.YG5714_0403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]