SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583112|ref|YP_002841511.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583112|ref|YP_002841511.1|
Domain Number 1 Region: 15-202
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 4.67e-61
Family FAD-linked oxidases, N-terminal domain 0.0054
Further Details:      
 
Domain Number 2 Region: 210-436
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 2.78e-42
Family Vanillyl-alcohol oxidase-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229583112|ref|YP_002841511.1|
Sequence length 451
Comment FAD linked oxidase domain-containing protein [Sulfolobus islandicus Y.N.15.51]
Sequence
MDFTELKDIEQKVEEREDFSGEKVRPLAVFFPKDEDEVVRIVRFAKKNRLPIIPWGQGTS
LTGAVSCDKNCILVDLSKMNKILEINDIDWYVRVQPGIKLIDLFEELEKKGFMLPPDPAS
FFLCSVGGAVAESSGGMKGVRHGSFREWVLSLRVVLPNGEVIKVGEPLRKNRAGYDLVHL
FVGSEGTLGIVTEIWLRIIPIPKRKMVMIAAMLKDFESAGEVIVGLRKNKILPELSEYVD
ADVVKALNKHLTANLKETEGGMLLISIEEDSVDDVLKVLEGKAVDIKITEGEEAEKLYSV
RSQAAIAVKAESKKVFYAEDIVVPVSKLPEAIRRLREIGEKYNTKFYVISHIGDGNLHPN
IIIEDKVAREKAFEEIARMAIELGGSVSGEHGIGVQKAKLMAEQIVKHNGVSVLDLMYQI
KKLIDPDDIMNPDKYVELAYKYLTSGDRSTI
Download sequence
Identical sequences C3NLN6
WP_012718038.1.52267 gi|229583112|ref|YP_002841511.1| 419942.YN1551_2671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]