SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583170|ref|YP_002841569.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583170|ref|YP_002841569.1|
Domain Number 1 Region: 8-269
Classification Level Classification E-value
Superfamily Purine and uridine phosphorylases 3.01e-97
Family Purine and uridine phosphorylases 0.00000000136
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229583170|ref|YP_002841569.1|
Sequence length 270
Comment 5'-methylthioadenosine phosphorylase [Sulfolobus islandicus Y.N.15.51]
Sequence
MIEENEKASIGIIGGSGLYDPGIFSESKERKVYTPYGEPSDLITIGKIGNKTVAFLPRHG
RRHRIPPHKINYRANIWALKELGVRWVISVSAVGSLRIDYKPGDFVIPDQFIDMTKKRDY
TFFDGPVVAHVSMADPFCNSLRKLALETAKELNIRTHESGTYICIEGPRFSTRAESRTWR
EVYKADIIGMTLVPEVNLACEAQMCYATIAMVTDYDVFAEIPVTAEEVTRVMAENTEKAK
KLLYALIQRLPEKPEEGSCSCCNSLKTALV
Download sequence
Identical sequences C3MK28 C3MTZ7 C3N0K9 C3N8J7 C3NM65 C4KK52 D2PEI8 F0NG89 F0NJ02 M9UBP1
419942.YN1551_2743 426118.M164_0159 427317.M1425_0140 427318.M1627_0140 429572.LS215_0171 439386.YG5714_0144 gi|238618636|ref|YP_002913461.1| gi|227826550|ref|YP_002828329.1| gi|385772164|ref|YP_005644730.1| WP_012710318.1.100559 WP_012710318.1.13477 WP_012710318.1.27011 WP_012710318.1.27461 WP_012710318.1.34992 WP_012710318.1.44962 WP_012710318.1.47130 WP_012710318.1.48461 WP_012710318.1.52267 WP_012710318.1.60638 WP_012710318.1.66823 WP_012710318.1.67233 WP_012710318.1.68242 WP_012710318.1.74483 WP_012710318.1.83431 WP_012710318.1.84481 WP_012710318.1.89621 WP_012710318.1.90709 WP_012710318.1.91160 WP_012710318.1.97021 gi|229583714|ref|YP_002842215.1| gi|479324560|ref|YP_007864608.1| gi|227829192|ref|YP_002830971.1| gi|229577961|ref|YP_002836359.1| gi|284996547|ref|YP_003418314.1| gi|229583170|ref|YP_002841569.1| gi|385774881|ref|YP_005647449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]