SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583197|ref|YP_002841596.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583197|ref|YP_002841596.1|
Domain Number 1 Region: 5-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 6.3e-31
Family GHMP Kinase, N-terminal domain 0.0000731
Further Details:      
 
Domain Number 2 Region: 169-290
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 2.12e-23
Family Homoserine kinase 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|229583197|ref|YP_002841596.1|
Sequence length 311
Comment homoserine kinase [Sulfolobus islandicus Y.N.15.51]
Sequence
MECKRARAYSSSANLGSGFDILSMAHTAFFDTVEICVETKNSENIVIESNSKIPLEPNRN
SATYPLVRIMEERGIKASLRVKVIKGIPEGLGLGSSGASATAAVMAFSSLFNLNLSKEDL
VRYAMYGEIASSGSPHPDNVAASVFGGVVSVVSVNPVKVVEIPLNYSFNILLFVPLNIHI
EEKTKKAREMVPKTVKLSDYINNSRYISSLLIGFVKGERDLIRLGLNDEIVEKARLPLFP
YYPKIKEIAIKYDAVGSCVSGAGPSILVLTDKMTDENKIAEEGTKTCNEFNVECEVIKAK
IAGGVEVERRN
Download sequence
Identical sequences C3N8M1 C3NM92 D2PEL2
gi|229577985|ref|YP_002836383.1| gi|284996571|ref|YP_003418338.1| gi|229583197|ref|YP_002841596.1| 419942.YN1551_2770 439386.YG5714_0168 WP_012715452.1.13477 WP_012715452.1.34992 WP_012715452.1.52267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]