SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|229583329|ref|YP_002841728.1| from Sulfolobus islandicus Y.N.15.51

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|229583329|ref|YP_002841728.1|
Domain Number 1 Region: 6-79
Classification Level Classification E-value
Superfamily Homeodomain-like 5.64e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0041
Further Details:      
 
Weak hits

Sequence:  gi|229583329|ref|YP_002841728.1|
Domain Number - Region: 100-178
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 0.000156
Family Tetracyclin repressor-like, C-terminal domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|229583329|ref|YP_002841728.1|
Sequence length 199
Comment TetR family transcriptional regulator [Sulfolobus islandicus Y.N.15.51]
Sequence
MVIQMYRYPKTEKGKESLNKIITASLDLISEKGFLNTSISDITNKAGVAYGLFYFYFKSK
HDILDELIRKFNTDMRYYLKVNTMGIQNRIEMEKEGLAKFLEWMSQNKKYYKVFVEAQVH
RPEMYIWHFTKLAERYKIGLKEAMDRGEIVKVDPELLAYVLIGIGEMIGRRYILWTNQGL
NKKQYNDLAILIENMLRPK
Download sequence
Identical sequences C3MKV2 C3N9D0 C3NMZ9 D2PFC6 F0NE59 F0NJ84
gi|385775041|ref|YP_005647609.1| gi|229583329|ref|YP_002841728.1| gi|385772323|ref|YP_005644889.1| gi|227829343|ref|YP_002831122.1| gi|284996702|ref|YP_003418469.1| WP_012712915.1.13477 WP_012712915.1.34992 WP_012712915.1.52267 WP_012712915.1.66823 WP_012712915.1.67233 WP_012712915.1.91160 gi|229578116|ref|YP_002836514.1| 419942.YN1551_2905 429572.LS215_0325 439386.YG5714_0301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]